Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macadamia integrifolia Antimicrobial peptide 1

This Recombinant Macadamia integrifolia Antimicrobial peptide 1 spans the amino acid sequence from region 27-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(AMP1) (MiAMP1)

UniProt

P80915

Expression Region

27-102aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macadamia integrifolia (Macadamia nut)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A5 Rabbit Polyclonal Antibody (Biotin)
orb3102737 100 µg

SLC26A5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CLIA kit for Human GUCA2B (Guanylate Cyclase Activator 2B)
E-CL-H0331 96 Tests

CLIA kit for Human GUCA2B (Guanylate Cyclase Activator 2B)

Sign In for Pricing
View Details
Human NEURL (NEURL1) activation kit by CRISPRa
GA106099 1 Kit

Human NEURL (NEURL1) activation kit by CRISPRa

Sign In for Pricing
View Details
OR4M1 (NM_001005500) Human Tagged Lenti ORF Clone
RC222415L1 10 µg

OR4M1 (NM_001005500) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Maleimido-tri (ethylene glycol) -propionic acid
HY-130426-01 50 mg

Maleimido-tri (ethylene glycol) -propionic acid

Sign In for Pricing
View Details
Maleimido-tri (ethylene glycol) -propionic acid
HY-130426-02 100 mg

Maleimido-tri (ethylene glycol) -propionic acid

Sign In for Pricing
View Details