Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHH, Mouse

DHH Protein, Mouse is a single non-glycosylated polypeptide chain. Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis.

Product Specifications

Product Name Alternative

DHH Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dhh-protein-mouse.html

Purity

95.0

Smiles

IGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG

Molecular Formula

13363 (Gene_ID) Q61488 (C23-G198, C23I) (Accession)

Molecular Weight

Approximately 20.1 kDa

References & Citations

[1]O'Hara WA, et al. Desert hedgehog is a mammal-specific gene expressed during testicular and ovarian development in a marsupial. BMC Dev Biol. 2011 Dec 1;11:72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Wnk4 shRNA (UAS) - Lentiviral mouse Wnk4 shRNA (UAS, RFP) plasmid
GTR15159037 1 Vial

Lentiviral mouse Wnk4 shRNA (UAS) - Lentiviral mouse Wnk4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit
MBS2501108-01 24 Tests

Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit

Sign In for Pricing
View Details
Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit
MBS2501108-02 48 Tests

Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit

Sign In for Pricing
View Details
Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit
MBS2501108-03 96 Tests

Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit

Sign In for Pricing
View Details
Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit
MBS2501108-04 5x 96 Tests

Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit

Sign In for Pricing
View Details
Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit
MBS2501108-05 10x 96 Tests

Sheep Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit

Sign In for Pricing
View Details