Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHH, Mouse

DHH Protein, Mouse is a single non-glycosylated polypeptide chain. Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis.

Product Specifications

Product Name Alternative

DHH Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dhh-protein-mouse.html

Purity

95.0

Smiles

IGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG

Molecular Formula

13363 (Gene_ID) Q61488 (C23-G198, C23I) (Accession)

Molecular Weight

Approximately 20.1 kDa

References & Citations

[1]O'Hara WA, et al. Desert hedgehog is a mammal-specific gene expressed during testicular and ovarian development in a marsupial. BMC Dev Biol. 2011 Dec 1;11:72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SOCS2 Rabbit Monoclonal Antibody, Carrier-free
M01584-1-carrier-free 100 µL

Anti-SOCS2 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Rat Protein PAT1 homolog 1, PATL1 ELISA Kit
MBS9336190-01 48 Well

Rat Protein PAT1 homolog 1, PATL1 ELISA Kit

Sign In for Pricing
View Details
Rat Protein PAT1 homolog 1, PATL1 ELISA Kit
MBS9336190-02 96 Well

Rat Protein PAT1 homolog 1, PATL1 ELISA Kit

Sign In for Pricing
View Details
Rat Protein PAT1 homolog 1, PATL1 ELISA Kit
MBS9336190-03 5x 96 Well

Rat Protein PAT1 homolog 1, PATL1 ELISA Kit

Sign In for Pricing
View Details
Rat Protein PAT1 homolog 1, PATL1 ELISA Kit
MBS9336190-04 10x 96 Well

Rat Protein PAT1 homolog 1, PATL1 ELISA Kit

Sign In for Pricing
View Details
NDRG2 (Protein NDRG2, N-myc Downstream-regulated Gene 2 Protein, Protein Syld709613, KIAA1248, SYLD, DKFZp781G1938, FLJ25522) (Biotin)
130199-Biotin 100 µL

NDRG2 (Protein NDRG2, N-myc Downstream-regulated Gene 2 Protein, Protein Syld709613, KIAA1248, SYLD, DKFZp781G1938, FLJ25522) (Biotin)

Sign In for Pricing
View Details