Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHH, Mouse

DHH Protein, Mouse is a single non-glycosylated polypeptide chain. Desert hedgehog protein (DHH) is a member of the Hedgehog family which encodes signaling molecules that play an important role in regulating morphogenesis.

Product Specifications

Product Name Alternative

DHH Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dhh-protein-mouse.html

Purity

95.0

Smiles

IGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG

Molecular Formula

13363 (Gene_ID) Q61488 (C23-G198, C23I) (Accession)

Molecular Weight

Approximately 20.1 kDa

References & Citations

[1]O'Hara WA, et al. Desert hedgehog is a mammal-specific gene expressed during testicular and ovarian development in a marsupial. BMC Dev Biol. 2011 Dec 1;11:72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vascular Endothelial Cell Growth Factor B CLIA Kit
MBS8427020-01 1 Kit

Rat Vascular Endothelial Cell Growth Factor B CLIA Kit

Sign In for Pricing
View Details
Rat Vascular Endothelial Cell Growth Factor B CLIA Kit
MBS8427020-02 5x 1 Kit

Rat Vascular Endothelial Cell Growth Factor B CLIA Kit

Sign In for Pricing
View Details
Recombinant Human FGF basic/FGF2/bFGF Protein
ABC-GF0045 10 μg, 50 μg, 100 μg, 1 mg

Recombinant Human FGF basic/FGF2/bFGF Protein

Sign In for Pricing
View Details
Mouse Rufy1 (NM_172557) AAV Particle
MR219869A1V 250 µL

Mouse Rufy1 (NM_172557) AAV Particle

Sign In for Pricing
View Details
Rat crystal proteins α (Cryα) ELISA Kit
NSL0871r 96 Tests

Rat crystal proteins α (Cryα) ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 10 (KLK10) Antibody Pair Kit (with Standard)
MBS2099328-01 5x 96 Tests

Human Kallikrein 10 (KLK10) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details