Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (Cd69), partial, Biotinylated

This Recombinant Human Early activation antigen CD69 (Cd69), partial, Biotinylated spans the amino acid sequence from region 62-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)

UniProt

Q07108

Expression Region

62-199aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Acetoacetyl CoA synthetase Antibody [DyLight 650]
NBP2-97174C 0.1 mL

Rabbit Polyclonal Acetoacetyl CoA synthetase Antibody [DyLight 650]

Sign In for Pricing
View Details
2310028O11Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4482005 3x 1.0 µg

2310028O11Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial)
479862 100 µL

ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial)

Sign In for Pricing
View Details
Recombinant Schistocerca americana Innexin inx2 (inx2)
MBS7017520-01 0.02 mg

Recombinant Schistocerca americana Innexin inx2 (inx2)

Sign In for Pricing
View Details
Recombinant Schistocerca americana Innexin inx2 (inx2)
MBS7017520-02 0.1 mg

Recombinant Schistocerca americana Innexin inx2 (inx2)

Sign In for Pricing
View Details
Recombinant Schistocerca americana Innexin inx2 (inx2)
MBS7017520-03 5x 0.1 mg

Recombinant Schistocerca americana Innexin inx2 (inx2)

Sign In for Pricing
View Details