Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human FAS-associated death domain protein (FADD)

This Recombinant Human FAS-associated death domain protein (FADD) spans the amino acid sequence from region 1-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FAS-associating death domain-containing protein) (Growth-inhibiting gene 3 protein) (Mediator of receptor induced toxicity)

UniProt

Q13158

Expression Region

1-208aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI6F6]
CF806088 100 µg

FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI6F6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS636945 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]
TA502094BM 100 µL

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF640R conjugate, 0.1mg/mL
BNC402210-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Boc-γ-aminobutyric Acid
TRC-N656140-2.5G 2.5 g

N-Boc-γ-aminobutyric Acid

Sign In for Pricing
View Details
Human HCCA2 (MOB2) activation kit by CRISPRa
GA113049 1 Kit

Human HCCA2 (MOB2) activation kit by CRISPRa

Sign In for Pricing
View Details