Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

This Recombinant Staphylococcus aureus DNA-binding protein HU (hup) spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5HFV0

Expression Region

1-90aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD14 Antibody[H332-1B10]
AN002130P-01 25 µg

Purified Anti-Human CD14 Antibody[H332-1B10]

Sign In for Pricing
View Details
Purified Anti-Human CD14 Antibody[H332-1B10]
AN002130P-02 100 µg

Purified Anti-Human CD14 Antibody[H332-1B10]

Sign In for Pricing
View Details
Human ZNF83 activation kit by CRISPRa
GA110954 1 Kit

Human ZNF83 activation kit by CRISPRa

Sign In for Pricing
View Details
FOXP1 Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF813710 100 µg

FOXP1 Mouse Monoclonal Antibody [Clone ID: OTI2H3]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB511189 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
MAGE 1 (MAGEA1) Mouse Monoclonal Antibody [Clone ID: MA454]
AM32863PU-T 20 µg

MAGE 1 (MAGEA1) Mouse Monoclonal Antibody [Clone ID: MA454]

Sign In for Pricing
View Details