Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

This Recombinant Staphylococcus aureus DNA-binding protein HU (hup) spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5HFV0

Expression Region

1-90aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Renin Recombinant Rabbit monoclonal Antibody
HA725170 100 µL

Human Renin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
(±)-Neoisomenthol
TRC-N389960-500MG 500 mg

(±)-Neoisomenthol

Sign In for Pricing
View Details
2-Propenyl-(propyl-d7)-propanedioic Acid Diethyl Ester
TRC-P769002-25MG 25 mg

2-Propenyl-(propyl-d7)-propanedioic Acid Diethyl Ester

Sign In for Pricing
View Details
DUSP1 Human Gene Knockout Kit (CRISPR)
KN205220 1 Kit

DUSP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-(4-Fluorophenyl)-1,3-thiazole
TRC-F402578-50MG 50 mg

4-(4-Fluorophenyl)-1,3-thiazole

Sign In for Pricing
View Details
Von Willebrand Factor Antibody
KC-26287-01 50 μL

Von Willebrand Factor Antibody

Sign In for Pricing
View Details