Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

This Recombinant Staphylococcus aureus DNA-binding protein HU (hup) spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5HFV0

Expression Region

1-90aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human SCN9A (Sodium voltage-gated channel alpha subunit 9) Full Length
MPC0710K Each

Magic™ Membrane Protein Human SCN9A (Sodium voltage-gated channel alpha subunit 9) Full Length

Sign In for Pricing
View Details
Mouse Monoclonal SPARC Antibody (rOSTN/8527) [DyLight 650]
NBP3-20948C 0.1 mL

Mouse Monoclonal SPARC Antibody (rOSTN/8527) [DyLight 650]

Sign In for Pricing
View Details
Slitrk1 3'UTR GFP Stable Cell Line
TU270786 1.0 mL

Slitrk1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AccuRapidTM Cloning Kit
K-7110 10 Reactions

AccuRapidTM Cloning Kit

Sign In for Pricing
View Details
SUV420H2 Protein Vector (Mouse) (pPM-C-His)
PV235433 500 ng

SUV420H2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Nipal1 Mouse shRNA Plasmid (Locus ID 70701)
TL517953 1 Kit

Nipal1 Mouse shRNA Plasmid (Locus ID 70701)

Sign In for Pricing
View Details