Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-2 (IL2)

This Recombinant Lama glama Interleukin-2 (IL2) spans the amino acid sequence from region 21-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-2) (T-cell growth factor) (TCGF)

UniProt

Q865X2

Expression Region

21-154aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Lama glama (Llama)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPSM1 (NM_001145638) Human Over-expression Lysate
LC428944 20 µg

GPSM1 (NM_001145638) Human Over-expression Lysate

Sign In for Pricing
View Details
all-trans-Geranyl Citronellol
TRC-G367300-25MG 25 mg

all-trans-Geranyl Citronellol

Sign In for Pricing
View Details
1,1-(Ethylenedioxy)-3-bromopropane
TRC-E678630-5G 5 g

1,1-(Ethylenedioxy)-3-bromopropane

Sign In for Pricing
View Details
SLC66A3 (NM_001282710) Human Tagged ORF Clone
RG236407 10 µg

SLC66A3 (NM_001282710) Human Tagged ORF Clone

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Amaranthus caudatus Lectin (Tassel flowerInca wheat) -ACA-
LA-8201-1 1 mg

Alkaline Phosphatase Conjugated Amaranthus caudatus Lectin (Tassel flowerInca wheat) -ACA-

Sign In for Pricing
View Details
5Beta-Pregnan-3Alpha-ol-20-one
TRC-P711300-5MG 5 mg

5Beta-Pregnan-3Alpha-ol-20-one

Sign In for Pricing
View Details