Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-2 (IL2)

This Recombinant Lama glama Interleukin-2 (IL2) spans the amino acid sequence from region 21-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-2) (T-cell growth factor) (TCGF)

UniProt

Q865X2

Expression Region

21-154aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Lama glama (Llama)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 (STK11) (NM_000455) Human Over-expression Lysate
E45H02928-2 20 µg

LKB1 (STK11) (NM_000455) Human Over-expression Lysate

Sign In for Pricing
View Details
IL8 (CXCL8) rabbit polyclonal antibody, Aff - Purified
PP1030P1 50 µg

IL8 (CXCL8) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
DYDC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
18749061 1.0 µg DNA

DYDC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Fmoc-HoPro-OH 25g
A22945-25000 25000 mg

Fmoc-HoPro-OH 25g

Sign In for Pricing
View Details
DNAJC27 Human Pre-designed siRNA Set A
HY-RS03883 1 Set

DNAJC27 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to IL-11
MBS8527471-01 0.1 mL

Mouse Monoclonal Antibody to IL-11

Sign In for Pricing
View Details