Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein cereblon (CRBN), partial

This Recombinant Human Protein cereblon (CRBN), partial spans the amino acid sequence from region 318-426aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96SW2

Expression Region

318-426aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0319-set siRNA/shRNA/RNAi Lentivector (Human)
25533091 4x 500 ng

KIAA0319-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
PXT1-set siRNA/shRNA/RNAi Lentivector (Human)
38241091 4x 500 ng

PXT1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
HUMAN T-CELL SURFACE MARKERS, CD4 (T4) / 169 bp (2 nmole)
N-1047 169 bp (2 nmole)

HUMAN T-CELL SURFACE MARKERS, CD4 (T4) / 169 bp (2 nmole)

Sign In for Pricing
View Details
MGST1 Recombinant Antibody, Cy3 Conjugated
bsm-62485R-Cy3-TR 20 µL

MGST1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Srgap2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7233105 3x 1.0 µg

Srgap2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
(3-Formyl-2-thienyl) boronic acid
OR10485-01 100 mg

(3-Formyl-2-thienyl) boronic acid

Sign In for Pricing
View Details