Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein cereblon (CRBN), partial

This Recombinant Human Protein cereblon (CRBN), partial spans the amino acid sequence from region 318-426aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96SW2

Expression Region

318-426aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG1-Biotin Conjugate (-ve control)
20007-G1-B 100 µg

Human IgG1-Biotin Conjugate (-ve control)

Sign In for Pricing
View Details
MRPL19 siRNA (Human)
orb1861698-01 15 nmol

MRPL19 siRNA (Human)

Sign In for Pricing
View Details
MRPL19 siRNA (Human)
orb1861698-02 30 nmol

MRPL19 siRNA (Human)

Sign In for Pricing
View Details
mmu-miR-7213-3p miRNA Antagomir
MNM02996 2x 5.0 nmol

mmu-miR-7213-3p miRNA Antagomir

Sign In for Pricing
View Details
Psmc6 Rat shRNA Plasmid (Locus ID 289990)
TL704095 1 Kit

Psmc6 Rat shRNA Plasmid (Locus ID 289990)

Sign In for Pricing
View Details
hsa-miR-4789-5p miRNA Inhibitor
MBS8294492-01 10 nmol

hsa-miR-4789-5p miRNA Inhibitor

Sign In for Pricing
View Details