Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thiamine transporter 2 (SLC19A3), partial

This Recombinant Human Thiamine transporter 2 (SLC19A3), partial spans the amino acid sequence from region 208-273aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ThTr-2) (ThTr2) (Solute carrier family 19 member 3)

UniProt

Q9BZV2

Expression Region

208-273aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHA7
522708-01 100 µL

EPHA7

Sign In for Pricing
View Details
EPHA7
522708-02 200 µL

EPHA7

Sign In for Pricing
View Details
Angiotensin 1-7 (Ang1-7) Antibody
abx179044-01 100 µL

Angiotensin 1-7 (Ang1-7) Antibody

Sign In for Pricing
View Details
Angiotensin 1-7 (Ang1-7) Antibody
abx179044-02 200 µL

Angiotensin 1-7 (Ang1-7) Antibody

Sign In for Pricing
View Details
Angiotensin 1-7 (Ang1-7) Antibody
abx179044-03 1 mL

Angiotensin 1-7 (Ang1-7) Antibody

Sign In for Pricing
View Details
Cytokeratin 19 (Ks19.1), 0.2mg/mL
BNUB0394-100 1x 100 µL

Cytokeratin 19 (Ks19.1), 0.2mg/mL

Sign In for Pricing
View Details