Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle transport protein USE1 (Use1), partial

This Recombinant Mouse Vesicle transport protein USE1 (Use1), partial spans the amino acid sequence from region 1-242aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein D12) (USE1-like protein)

UniProt

Q9CQ56

Expression Region

1-242aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGALEDMLQALKVQASKPASEVISEYSRKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTAKERVPATKTVHLQSRARYTSEMRSELLGMEPSGECEVDMRKRAAKGSRPADERQSASELDLVLQRHQGLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKLESERLEQHAQKSVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycosolone
HY-N3958 1 Each

Glycosolone

Sign In for Pricing
View Details
Synphilin-1 Polyclonal Antibody
RA30212-01 50 µL

Synphilin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Synphilin-1 Polyclonal Antibody
RA30212-02 100 µL

Synphilin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to OCT1
35-1842-50 50 μL

Polyclonal Antibody to OCT1

Sign In for Pricing
View Details
Jam 2-263
orb1696876 25 mg

Jam 2-263

Sign In for Pricing
View Details
GLUT 6 (Glucose Transporter 6, Glucose Transporter Type 6, GLUT6, GLUT-6, Glucose Transporter Type 9, GLUT9, GLUT-9, HSA011372, Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 6, SLC2A6) (PE) discontinued
137993-PE 100 µL

GLUT 6 (Glucose Transporter 6, Glucose Transporter Type 6, GLUT6, GLUT-6, Glucose Transporter Type 9, GLUT9, GLUT-9, HSA011372, Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 6, SLC2A6) (PE) discontinued

Sign In for Pricing
View Details