Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vesicle transport protein USE1 (Use1), partial

This Recombinant Mouse Vesicle transport protein USE1 (Use1), partial spans the amino acid sequence from region 1-242aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein D12) (USE1-like protein)

UniProt

Q9CQ56

Expression Region

1-242aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGALEDMLQALKVQASKPASEVISEYSRKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTAKERVPATKTVHLQSRARYTSEMRSELLGMEPSGECEVDMRKRAAKGSRPADERQSASELDLVLQRHQGLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKLESERLEQHAQKSVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Delta-9 desaturase-like 2 protein (At1g06100), partial
MBS7099272 Inquire

Recombinant Arabidopsis thaliana Delta-9 desaturase-like 2 protein (At1g06100), partial

Sign In for Pricing
View Details
(5-Phenyl-1,2,4-oxadiazol-3-yl) methanol
YCA21737-01 0.5 g

(5-Phenyl-1,2,4-oxadiazol-3-yl) methanol

Sign In for Pricing
View Details
(5-Phenyl-1,2,4-oxadiazol-3-yl) methanol
YCA21737-02 5 g

(5-Phenyl-1,2,4-oxadiazol-3-yl) methanol

Sign In for Pricing
View Details
Research Grade Inotuzumab
DHD38502 100 μg

Research Grade Inotuzumab

Sign In for Pricing
View Details
AHRR Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV679463 1.0 µg DNA

AHRR Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Anti-SLC30A2 Antibody Picoband®, Cy3 Conjugate
A06643-2-Cy3 100 µg/Vial

Anti-SLC30A2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details