Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Piezo-type mechanosensitive ion channel component 2 (PIEZO2), partial

This Recombinant Human Piezo-type mechanosensitive ion channel component 2 (PIEZO2), partial spans the amino acid sequence from region 2427-2661aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein FAM38B)

UniProt

Q9H5I5

Expression Region

2427-2661aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILSRDNTTKYNSEWWVLNLTGNRIYNPNSQALELVVFNDKVSPPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiWell™ Deep Well Plates
D3096-05 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
10X Buffer V5, 5 x 1ml
RB0212 5x 1 mL

10X Buffer V5, 5 x 1ml

Sign In for Pricing
View Details
Aloe-emodin-D4 (major)
TRC-A575403-5MG 5 mg

Aloe-emodin-D4 (major)

Sign In for Pricing
View Details
Pea3 (ETV4) Mouse Monoclonal Antibody [Clone ID: OTI5C11]
CF811432 100 µg

Pea3 (ETV4) Mouse Monoclonal Antibody [Clone ID: OTI5C11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS624966 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
PAX6 (Center) Rabbit Polyclonal Antibody
AP17622PU-N 400 µL

PAX6 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details