Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Otoraplin (Otor)

This Recombinant Mouse Otoraplin (Otor) spans the amino acid sequence from region 19-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Melanoma inhibitory activity-like protein)

UniProt

Q9JIE3

Expression Region

19-128aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGVFMDKLSSKKLCADEECVYTISLARAQEDYNAPDCRFIDVKKGQQIYVYSKLVTENGAGEFWAGSVYGDHQDEMGIVGYFPSNLVKEQRVYQEATKEIPTTDIDFFCE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Endometrial Adenocarcinoma CAFs
CAF01 1000000 Cells

Human Endometrial Adenocarcinoma CAFs

Sign In for Pricing
View Details
AKAP2 Antibody
MBS9604939-01 0.1 mL

AKAP2 Antibody

Sign In for Pricing
View Details
AKAP2 Antibody
MBS9604939-02 0.2 mL

AKAP2 Antibody

Sign In for Pricing
View Details
AKAP2 Antibody
MBS9604939-03 5x 0.2 mL

AKAP2 Antibody

Sign In for Pricing
View Details
CEND1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-62057R-APC-Cy7 100 µL

CEND1 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
PCDHGC4 Human Pre-designed siRNA Set A
HY-RS10143 1 Set

PCDHGC4 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details