Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens DNA-binding protein HU-beta (hupB)

This Recombinant Pseudomonas fluorescens DNA-binding protein HU-beta (hupB) spans the amino acid sequence from region 1-90aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9KHS6

Expression Region

1-90aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKSELIDAIAASADLPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARIGRNPQTGKTLEIAAAKKPGFKAGKALKEAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Abl, phosphorylated (Tyr134) (ABL, Tyrosine-protein Kinase ABL1, Abelson Murine Leukemia Viral Oncogene Homolog 1, Proto-oncogene c-Abl, p150, ABL1, JTK7) (MaxLight 650) discontinued
C0013-04D-ML650 100 µL

C-Abl, phosphorylated (Tyr134) (ABL, Tyrosine-protein Kinase ABL1, Abelson Murine Leukemia Viral Oncogene Homolog 1, Proto-oncogene c-Abl, p150, ABL1, JTK7) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Lrrc19 qPCR Primer Pair
QM48546S 200 Tests

Mouse Lrrc19 qPCR Primer Pair

Sign In for Pricing
View Details
RAP1GAP2 (NM_015085) Human Over-expression Lysate
LS023108-100ug 100 µg

RAP1GAP2 (NM_015085) Human Over-expression Lysate

Sign In for Pricing
View Details
TFF1 Antibody
OAAN03252-200UL 200 µL

TFF1 Antibody

Sign In for Pricing
View Details
Env Antibody
orb843014 2 mg

Env Antibody

Sign In for Pricing
View Details
P38 MAPK (Phospho-Thr179+Tyr181) Antibody
8A0799-AAT 50 µg

P38 MAPK (Phospho-Thr179+Tyr181) Antibody

Sign In for Pricing
View Details