Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens DNA-binding protein HU-beta (hupB)

This Recombinant Pseudomonas fluorescens DNA-binding protein HU-beta (hupB) spans the amino acid sequence from region 1-90aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9KHS6

Expression Region

1-90aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKSELIDAIAASADLPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARIGRNPQTGKTLEIAAAKKPGFKAGKALKEAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Boc-N-desethyl Acetildenafil
sc-503885 5 mg

N-Boc-N-desethyl Acetildenafil

Sign In for Pricing
View Details
Human OR2V2 Pre-designed siRNA Set B
SI011238B 1 Each

Human OR2V2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Pyrrolidine-2-carboxaldehyde, N-CBZ protected
OR6182 250 mg

Pyrrolidine-2-carboxaldehyde, N-CBZ protected

Sign In for Pricing
View Details
5- (1-Benzothien-3-yl) -4-ethyl-4H-1,2,4-triazole-3-thiol
sc-317315 500 mg

5- (1-Benzothien-3-yl) -4-ethyl-4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
14-3-3 zeta/delta Antibody
DF3495-01 100 µL

14-3-3 zeta/delta Antibody

Sign In for Pricing
View Details
14-3-3 zeta/delta Antibody
DF3495-02 200 µL

14-3-3 zeta/delta Antibody

Sign In for Pricing
View Details