Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human parechovirus 2 Genome polyprotein, partial, Biotinylated

This Recombinant Human parechovirus 2 Genome polyprotein, partial, Biotinylated spans the amino acid sequence from region 1-290aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(P1AB) (Virion protein 0) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (P2A) (Protein 2A) (P2B) (P2C) (P3A) (VPg) (Protein 3B) (P3B) (P3C) (Picornain 3C) (P3D-POL)

UniProt

Q9YID8

Expression Region

1-290aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Human parechovirus 5 (strain CT86-6760) (HPeV-5) (Echovirus 23)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

79.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

METIKSIADMATGFTNTIDSTVNAVTEGVSKIGNDSGGEILTKVADDASNLLGPNCVASTSQPENKDVVQATTTVNTLTNLTQHPSAPTMPFTPDFSNVDVFHSMAYDITTGDKNPSKLIRLDTTTWQHTWPRQHLINDVELPKAFWDKNSKPAYGQSRYFAAVRCGFHFQVQINVNQGTAGCALVVYEPKPIVTHGGHLEFGSYTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSDLGRLRVYVWTPLTIPSSATNDVDVTVLGSLLQLDFQNPRTYDTDVNIYDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complete Medium for Human Rectal Smooth Muscle Cells
abx703952-01 100 mL

Complete Medium for Human Rectal Smooth Muscle Cells

Sign In for Pricing
View Details
Complete Medium for Human Rectal Smooth Muscle Cells
abx703952-02 500 mL

Complete Medium for Human Rectal Smooth Muscle Cells

Sign In for Pricing
View Details
Rabbit anti-PYGM Antibody
DL98459A-01 50 µL

Rabbit anti-PYGM Antibody

Sign In for Pricing
View Details
Rabbit anti-PYGM Antibody
DL98459A-02 100 µL

Rabbit anti-PYGM Antibody

Sign In for Pricing
View Details
GCDH shRNA Plasmid (m)
sc-145359-SH 20 µg

GCDH shRNA Plasmid (m)

Sign In for Pricing
View Details
N WASP monoclonal antibody
orb1723773-01 50 µL

N WASP monoclonal antibody

Sign In for Pricing
View Details