Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Probable protein E5 (E5)

This Recombinant Human papillomavirus type 16 Probable protein E5 (E5) spans the amino acid sequence from region 1-83aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P06927

Expression Region

1-83aa

Tag

N-terminal 10xHis-tagged and C-terminal GST-tagged

Source

In vitro E.coli expression system

Origin

Human papillomavirus type 16

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYIPLFLIHTHARFLIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish FGF20A Rabbit Polyclonal Antibody (Fluoro594)
orb3090505 100 µg

Zebrafish FGF20A Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Complement Component 4 Binding Protein (C4 Binding Protein, C4BP, Complement Component 4 Binding Protein alpha Chain, C4b Binding Protein alpha Chain, C4BPA, Complement Component 4 Binding Protein beta Chain, C4b Binding Protein beta Chain, C4BPB, Proline-rich Protein, PRP) (PE)
C7850-19D1-PE 100 µL

Complement Component 4 Binding Protein (C4 Binding Protein, C4BP, Complement Component 4 Binding Protein alpha Chain, C4b Binding Protein alpha Chain, C4BPA, Complement Component 4 Binding Protein beta Chain, C4b Binding Protein beta Chain, C4BPB, Proline-rich Protein, PRP) (PE)

Sign In for Pricing
View Details
Cdk4 Antibody
orb433092 0.1 mg

Cdk4 Antibody

Sign In for Pricing
View Details
Recombinant Human Hydroxycarboxylic acid receptor 3 (HCAR3), partial
MBS7061150 Inquire

Recombinant Human Hydroxycarboxylic acid receptor 3 (HCAR3), partial

Sign In for Pricing
View Details
Human CKLF-like MARVEL transmembrane domain-containing protein 3 (CMTM3) ELISA Kit
abx507000 96 Tests

Human CKLF-like MARVEL transmembrane domain-containing protein 3 (CMTM3) ELISA Kit

Sign In for Pricing
View Details
3- (2-Hydroxyethoxy) propan-1-ol
OR1056673-01 100 mg

3- (2-Hydroxyethoxy) propan-1-ol

Sign In for Pricing
View Details