Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active)
Selected Variant
GTR19028330-01
Size: 20 µg
This Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active) spans the amino acid sequence from region 20-104aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Expression Region
20-104aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL.
Form
Lyophilized powder
Molecular Weight
11.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
AA Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2236-500 1x 500 µL
Cystatin A (CPTC-CSTA-1), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PB9822-PE 100 µg/Vial
Anti-SULT2B1 Antibody Picoband® (PE Conjugate)
Sign In for Pricing
View Details 
BNC471533-500 1x 500 µL
Villin (GI-Mucosal & Urogenital Brush Border Marker) (VIL1/1314 + VIL1/2376), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470183-500 1x 500 µL
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PA2181-2-Cy3 100 µg/Vial
Anti-Hyaluronidase-1 HYAL1 Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details 
BNCB1841-100 1x 100 µL
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details