Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

This Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active) spans the amino acid sequence from region 27-274aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)

UniProt

P09758

Expression Region

27-274aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.7284-1.075 ng/mL.

Form

Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL
BNC940630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), 1mg/mL
BNUM0181-50 1x 50 µL

CD59 (heavy chain of Protectin) (BRA-10G), 1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL
BNC400718-100 1x 100 µL

HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL
BNC041950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF488A conjugate, 0.1mg/mL
BNC881857-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details