Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S), partial

This Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial spans the amino acid sequence from region 16-685aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S glycoprotein) (E2) (Peplomer protein)

UniProt

P0DTC2

Expression Region

16-685aa

Tag

N-terminal 6xHis-PDI-tagged

Source

Yeast

Origin

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Field of Research

Respiratory Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

133.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CPT1B Antibody Picoband®, Carrier-free
A03558-carrier-free 100 µg/Vial

Anti-CPT1B Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
SANITAIRWARMWATER450X52RL-T1-LL-P16 Pipe Markers for Water
N006262 30 Pack (30 Marker (s) x 1 Roll)

SANITAIRWARMWATER450X52RL-T1-LL-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized rhomboid protein C19B12.06c (SPAC19B12.06c)
orb2911510-01 20 µg

Recombinant Schizosaccharomyces pombe Uncharacterized rhomboid protein C19B12.06c (SPAC19B12.06c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized rhomboid protein C19B12.06c (SPAC19B12.06c)
orb2911510-02 100 µg

Recombinant Schizosaccharomyces pombe Uncharacterized rhomboid protein C19B12.06c (SPAC19B12.06c)

Sign In for Pricing
View Details
PCDNA3.1-TRAF2 (human) -3xMyc
BZ23050 1 Vial

PCDNA3.1-TRAF2 (human) -3xMyc

Sign In for Pricing
View Details
GGA1 Human Over-expression Lysate
orb1359390 20 µg

GGA1 Human Over-expression Lysate

Sign In for Pricing
View Details