Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Glycine cleavage system H protein, mitochondrial (GCSH)

This Recombinant Chicken Glycine cleavage system H protein, mitochondrial (GCSH) spans the amino acid sequence from region 40-164aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lipoic acid-containing protein

UniProt

P11183

Expression Region

40-164aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SARKFTDKHEWISVENGIGTVGISNFAQEALGDVVYCSLPEIGTKLNKDDEFGALESVKAASELYSPLTGEVTDINAALADNPGLVNKSCYQDGWLIKMTVEKPAELDELMSEDAYEKYIKSIED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDD4 Rabbit Polyclonal Antibody
TA319441 100 µg

NEDD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRIT1 Human qPCR Primer Pair (NM_015613)
HP211730 200 Reactions

LRIT1 Human qPCR Primer Pair (NM_015613)

Sign In for Pricing
View Details
Human ADGRE4P qPCR Primer Pair
QH72381S 200 Tests

Human ADGRE4P qPCR Primer Pair

Sign In for Pricing
View Details
4- (Hydrazinomethylidene) -2-methyltetrahydrofuran-3-one
OR24009 1 Each

4- (Hydrazinomethylidene) -2-methyltetrahydrofuran-3-one

Sign In for Pricing
View Details
Recombinant Rat Alkaline Sphingomyelinase (Alk-Smase)
RPU53343-01 50 µg

Recombinant Rat Alkaline Sphingomyelinase (Alk-Smase)

Sign In for Pricing
View Details
Recombinant Rat Alkaline Sphingomyelinase (Alk-Smase)
RPU53343-02 100 µg

Recombinant Rat Alkaline Sphingomyelinase (Alk-Smase)

Sign In for Pricing
View Details