Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Myelin basic protein (Mbp)

This Recombinant Mouse Myelin basic protein (Mbp) spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin A1 protein

UniProt

P04370

Expression Region

1-250aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adipose Triglyceride Lipase (ATGL) Antibody
abx230680 100 µg

Adipose Triglyceride Lipase (ATGL) Antibody

Sign In for Pricing
View Details
Traf4af1 siRNA Oligos set (Rat)
47436176 3x 5 nmol

Traf4af1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Butyrophilin-like9; BTNL9 Protein (C-Fc, Human)
P513568 100 µg

Butyrophilin-like9; BTNL9 Protein (C-Fc, Human)

Sign In for Pricing
View Details
Mouse Monoclonal L1CAM Antibody (UJ127) [Allophycocyanin/Cy7]
FAB7771APCCY7 0.1 mL

Mouse Monoclonal L1CAM Antibody (UJ127) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Rabbit Polyclonal PCGF5 Antibody
NBP3-17414-100ul 100 µL

Rabbit Polyclonal PCGF5 Antibody

Sign In for Pricing
View Details
Canine Cardiac Troponin I (cTn-I) ELISA kit
CSB-E08772c-01 96 Tests

Canine Cardiac Troponin I (cTn-I) ELISA kit

Sign In for Pricing
View Details