Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease 1 (PRSS1)

This Recombinant Human Serine protease 1 (PRSS1) spans the amino acid sequence from region 24-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Anionic trypsin I) (Beta-trypsin) (Cationic trypsinogen) (Pretrypsinogen I) (Trypsin I) (TRP1) (TRY1) (TRYP1)

UniProt

P07477

Expression Region

24-247aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNF5 (SMARCB1) Mouse Monoclonal Antibody [Clone ID: 25]
AM10099SU-N 1 mL

SNF5 (SMARCB1) Mouse Monoclonal Antibody [Clone ID: 25]

Sign In for Pricing
View Details
EpCAM Recombinant Rabbit monoclonal Antibody
HA720218F 100 µL

EpCAM Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tmem252 Mouse Gene Knockout Kit (CRISPR)
KN517836 1 Kit

Tmem252 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EBNA1 binding protein 2 (EBNA1BP2) (NM_001159936) Human Over-expression Lysate
LY431320 100 µg

EBNA1 binding protein 2 (EBNA1BP2) (NM_001159936) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Swine IgG,
AA-2359-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Polyclonal Antibody to Swine IgG,

Sign In for Pricing
View Details
Collagen IV Rabbit Polyclonal Antibody
HA500197 100 µL

Collagen IV Rabbit Polyclonal Antibody

Sign In for Pricing
View Details