Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 subunit beta (IL12B)

This Recombinant Human Interleukin-12 subunit beta (IL12B) spans the amino acid sequence from region 23-328aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)

UniProt

P29460

Expression Region

23-328aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1qtnf5 Mouse Gene Knockout Kit (CRISPR)
KN502354 1 Kit

C1qtnf5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIVA (SIVA1) (NM_006427) Human Recombinant Protein
TP315680L 1 mg

SIVA (SIVA1) (NM_006427) Human Recombinant Protein

Sign In for Pricing
View Details
FPRL1 (FPR2) (C-term) Rabbit Polyclonal Antibody
AP26414AF-N 100 µg

FPRL1 (FPR2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Monoclonal Antibody [Clone ID: R03-2K5]
TA385330 100 µL

STAT1 Rabbit Monoclonal Antibody [Clone ID: R03-2K5]

Sign In for Pricing
View Details
Trihexylamine
TRC-T794540-1G 1 g

Trihexylamine

Sign In for Pricing
View Details
DMNP-EDTA (Caged Calcium)
#50050 1x 5 mg

DMNP-EDTA (Caged Calcium)

Sign In for Pricing
View Details