Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus tubingensis Epoxide hydrolase

This Recombinant Aspergillus tubingensis Epoxide hydrolase spans the amino acid sequence from region 1-395aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

T2FEN1

Expression Region

1-395aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus tubingensis

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALAHSNIPSGTTVIPSPFQVHVSDEQIEELQLLVKLSKLAPPTYEGLQQDRKYGITNEWLANAKEAWKSLDWRSAESRINSFPQFTYDIEGLTIHFVALFSERKDAIPIVLLHGWPGSFLEFLPALTSIRDKYSPETLPYHIVIPSLPGFTFSSGPPLDVNFTGVDTARVINKVMLNLGFEDGYVAQGGDIGSRIGRILAVDHESCKAVHLNACYMGKPSNVPDTAITEEDKRALARAQWFGTYGSGYALEHGTRPSTIGNVLSTNPVALLAWIGEKFLDWADEAVPLESILESVSLYWFTETFPRSIYHYRENVPPPKLRQAEDPRWYIRKPFGFSYYPKELVPTPRAWVETTGNLVFWQAHEKGGHFAALERPQDFLNDLTAFCEQVWAGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Importin subunit beta-1 (KPNB1) ELISA Kit
MBS2605339-01 48 Well

Rat Importin subunit beta-1 (KPNB1) ELISA Kit

Sign In for Pricing
View Details
Rat Importin subunit beta-1 (KPNB1) ELISA Kit
MBS2605339-02 96 Well

Rat Importin subunit beta-1 (KPNB1) ELISA Kit

Sign In for Pricing
View Details
Rat Importin subunit beta-1 (KPNB1) ELISA Kit
MBS2605339-03 5x 96 Well

Rat Importin subunit beta-1 (KPNB1) ELISA Kit

Sign In for Pricing
View Details
Rat Importin subunit beta-1 (KPNB1) ELISA Kit
MBS2605339-04 10x 96 Well

Rat Importin subunit beta-1 (KPNB1) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Pol Iota Antibody, Affinity Purified
A301-304A-T 2 µg

Rabbit anti-Pol Iota Antibody, Affinity Purified

Sign In for Pricing
View Details
Asic3 Mouse Pre-designed siRNA Set A
HY-RS17225 1 Set

Asic3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details