Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-11/BMP-11, Human (HEK293, solution)

The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

GDF-11/BMP-11 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-11-bmp-11-protein-human-hek293-solution.html

Purity

98.00

Smiles

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Molecular Formula

10220 (Gene_ID) O95390 (N299-S407) (Accession)

Molecular Weight

Approximately 13.0-20 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HESRG (Embryonic Stem Cell-Related gene Protein, hES Cell-Related gene Protein, ESRG, HESRG) (MaxLight 405)
MBS6456497-01 0.1 mL

HESRG (Embryonic Stem Cell-Related gene Protein, hES Cell-Related gene Protein, ESRG, HESRG) (MaxLight 405)

Ask
View Details
HESRG (Embryonic Stem Cell-Related gene Protein, hES Cell-Related gene Protein, ESRG, HESRG) (MaxLight 405)
MBS6456497-02 5x 0.1 mL

HESRG (Embryonic Stem Cell-Related gene Protein, hES Cell-Related gene Protein, ESRG, HESRG) (MaxLight 405)

Ask
View Details
Mouse Monoclonal VCAM-1/CD106 Antibody (B-K9) [mFluor Violet 500 SE]
NBP2-47864MFV500 0.1 mL

Mouse Monoclonal VCAM-1/CD106 Antibody (B-K9) [mFluor Violet 500 SE]

Ask
View Details
S100A8 Polyclonal Antibody
ANT-14262-100ug 100 µg

S100A8 Polyclonal Antibody

Ask
View Details
Camel Progesterone (PROG) ELISA Kit
SL0028Cm-01 96 Tests

Camel Progesterone (PROG) ELISA Kit

Ask
View Details
Camel Progesterone (PROG) ELISA Kit
SL0028Cm-02 48 Tests

Camel Progesterone (PROG) ELISA Kit

Ask
View Details