GDF-11/BMP-11, Human (HEK293, solution)
The GDF-11/BMP-11 protein is a secreted signaling protein that globally regulates anterior/posterior axis patterning during development and plays a key role in mesoderm and neural tissue patterning. GDF-11/BMP-11 is critical for vertebral and orofacial development and signals through type 2 activin receptors (ACVR2A and ACVR2B) and type 1 activin receptors (ACVR1B, ACVR1C and TGFBR1), leading to SMAD2 and SMAD3 phosphorylation. GDF-11/BMP-11 Protein, Human (HEK293, solution) is the recombinant human-derived GDF-11/BMP-11 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
GDF-11/BMP-11 Protein, Human (HEK293, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-11-bmp-11-protein-human-hek293-solution.html
Purity
98.00
Smiles
NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Molecular Formula
10220 (Gene_ID) O95390 (N299-S407) (Accession)
Molecular Weight
Approximately 13.0-20 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
BD-4 (Beta-defensin 104, Beta-defensin 4, DEFB104A, DEFB-4, hBD-4, Defensin, beta 104, DEFB104, DEFB4, DEFB104B) (MaxLight 650)
BD-4 (Beta-defensin 104, Beta-defensin 4, DEFB104A, DEFB-4, hBD-4, Defensin, beta 104, DEFB104, DEFB4, DEFB104B) (MaxLight 650)
Itga10 (NM_001081053) Mouse Tagged ORF Clone Lentiviral Particle