Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Purine nucleoside phosphorylase (Pnp)

This Recombinant Rat Purine nucleoside phosphorylase (Pnp) spans the amino acid sequence from region 1-289aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PNP) (Inosine phosphorylase) (Inosine-guanosine phosphorylase)

UniProt

P85973

Expression Region

1-289aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Rattus norvegicus (Rat)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MENEFTYEDYQRTAEWLRSHTKHRPQVAVICGSGLGGLTAKLTQPQAFDYNEIPNFPQSTVQGHAGRLVFGFLNGRSCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFNAWKQMGEQRELQEGTYIMSAGPTFETVAESCLLRMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYNNLEKASHQEVLEAGKAAAQKLEQFVSILMESIPPRERAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT-CO1 Antibody, FITC conjugated
A29026-50UG 50 µg

MT-CO1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Caprin-2 (CAPRIN2) Antibody (FITC)
abx346592-01 50 µL

Caprin-2 (CAPRIN2) Antibody (FITC)

Sign In for Pricing
View Details
Caprin-2 (CAPRIN2) Antibody (FITC)
abx346592-02 100 µL

Caprin-2 (CAPRIN2) Antibody (FITC)

Sign In for Pricing
View Details
Caprin-2 (CAPRIN2) Antibody (FITC)
abx346592-03 200 µL

Caprin-2 (CAPRIN2) Antibody (FITC)

Sign In for Pricing
View Details
Caprin-2 (CAPRIN2) Antibody (FITC)
abx346592-04 1 mL

Caprin-2 (CAPRIN2) Antibody (FITC)

Sign In for Pricing
View Details
Human ANAPC1 Pre-designed siRNA Set B
SI000648B 1 Each

Human ANAPC1 Pre-designed siRNA Set B

Sign In for Pricing
View Details