Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dexamethasone-induced Ras-related protein 1 (Rasd1)

This Recombinant Mouse Dexamethasone-induced Ras-related protein 1 (Rasd1) spans the amino acid sequence from region 1-280aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O35626

Expression Region

1-280aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSVHSDLMYIREKTSVGSQAKDKERCVIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHYH Protein, Human, Recombinant
MBS8121391-01 0.1 mg

PHYH Protein, Human, Recombinant

Sign In for Pricing
View Details
PHYH Protein, Human, Recombinant
MBS8121391-02 5x 0.1 mg

PHYH Protein, Human, Recombinant

Sign In for Pricing
View Details
Whatman Puradisc PTFE 13mm 0.2um
FIL2768 10 / PCK

Whatman Puradisc PTFE 13mm 0.2um

Sign In for Pricing
View Details
Anti-N4BP1 Antibody Picoband®, FITC Conjugate
A12575-3-FITC 100 µg/Vial

Anti-N4BP1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
INPP4B (NM_001101669) Human Untagged Clone
SC316846 10 µg

INPP4B (NM_001101669) Human Untagged Clone

Sign In for Pricing
View Details
Tmc6 Mouse Gene Knockout Kit (CRISPR)
KN517663 1 Kit

Tmc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details