Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin (CALR)

This Recombinant Human Calreticulin (CALR) spans the amino acid sequence from region 18-417aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60 ERp60) (HACBP) (grp60)

UniProt

P27797

Expression Region

18-417aa

Tag

C-terminal flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBXIP (LAMTOR5) (NM_006402) Human Over-expression Lysate
LC401923 20 µg

HBXIP (LAMTOR5) (NM_006402) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human NEIL1 Protein (His Tag)
PKSH030794 50 µg

Recombinant Human NEIL1 Protein (His Tag)

Sign In for Pricing
View Details
2-Amino-1-(3-hydroxyphenyl)-1-propanone Hydrochloride
TRC-A609885-10MG 10 mg

2-Amino-1-(3-hydroxyphenyl)-1-propanone Hydrochloride

Sign In for Pricing
View Details
CLPP Recombinant Rabbit Monoclonal Antibody [JE40-00]
HA721503 100 µL

CLPP Recombinant Rabbit Monoclonal Antibody [JE40-00]

Sign In for Pricing
View Details
Cytochrome C (CTC05), 0.2mg/mL
BNUB0887-100 1x 100 µL

Cytochrome C (CTC05), 0.2mg/mL

Sign In for Pricing
View Details
FBXL2 Rabbit Polyclonal Antibody
TA376150 100 µL

FBXL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details