Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)

Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)

Product Specifications

Product Name Alternative

ASAH2-like protein; Putative inactive N-acylsphingosine amidohydrolase 2B; Putative inactive non-lysosomal ceramidase B

UniProt

P0C7U1

Tag

N-terminal 6xHis-tagged

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Tris-based buffer50% glycerol

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

AA Sequence

MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf35 Antibody
KC-35459-01 50 μL

C1orf35 Antibody

Sign In for Pricing
View Details
C1orf35 Antibody
KC-35459-02 100 µL

C1orf35 Antibody

Sign In for Pricing
View Details
C1orf35 Antibody
KC-35459-03 1 mL

C1orf35 Antibody

Sign In for Pricing
View Details
MAGic Clamp™ magnetic clamp, one microplate (max. 4)
H1000-MR-MP 1 Each

MAGic Clamp™ magnetic clamp, one microplate (max. 4)

Sign In for Pricing
View Details
MMS2 (UBE2V2) Rabbit Polyclonal Antibody
TA365468 100 µL

MMS2 (UBE2V2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H-Glu(otbu)-nh2 hydrochloride
TRC-G598243-500MG 500 mg

H-Glu(otbu)-nh2 hydrochloride

Sign In for Pricing
View Details