Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
Recombinant Human Putative inactive neutral ceramidase B (ASAH2B)
Product Specifications
Product Name Alternative
ASAH2-like protein; Putative inactive N-acylsphingosine amidohydrolase 2B; Putative inactive non-lysosomal ceramidase B
UniProt
P0C7U1
Tag
N-terminal 6xHis-tagged
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Tris-based buffer50% glycerol
Molecular Weight
23 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
AA Sequence
MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![NQO2 Mouse Monoclonal Antibody [Clone ID: AT1E3]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc528/imageurl/am09380pu-n.webp)
AM09380PU-N 100 µL
NQO2 Mouse Monoclonal Antibody [Clone ID: AT1E3]
Sign In for Pricing
View Details 
TRC-P783402-50MG 50 mg
Propionaldehyde 2,4-Dinitrophenylhydrazone-d3
Sign In for Pricing
View Details 