Recombinant Human Active regulator of SIRT1 protein (RPS19BP1)
Recombinant Human Active regulator of SIRT1 protein (RPS19BP1)
Product Specifications
Product Name Alternative
40S ribosomal protein S19-binding protein 1 Short name: RPS19-binding protein 1 Short name: S19BP
UniProt
Q86WX3
Tag
N-terminal GST-tagged
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Tris-based buffer50% glycerol
Molecular Weight
42.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
AA Sequence
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400783-500 1x 500 µL
Pmel17 / gp100 / SILV (PMEL/783), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740488-100 1x 100 µL
Topoisomerase I, MT (TOP1MT/488), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940200-100 1x 100 µL
MHC II (HLA-DQ) (SPV-L3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740949-100 1x 100 µL
Cytokeratin 7/17 (C-46), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details