GM-CSF, Rat (CHO)
GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.
Product Specifications
Product Name Alternative
GM-CSF Protein, Rat (CHO), Rat, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gm-csf-protein-rat-cho.html
Purity
95.00
Smiles
APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Molecular Formula
116630 (Gene_ID) P48750 (A18-K144) (Accession)
Molecular Weight
Approximately 16-26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]van Nieuwenhuijze A, et al. GM-CSF as a therapeutic target in inflammatory diseases. Mol Immunol. 2013 Dec;56 (4) :675-82.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403108-100 1x 100 µL
OX40 / CD134/ TNFRSF4 (Immuno-Oncology Target) (OX40/3108), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN200700LP 1 Kit
PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details