Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Rat (CHO)

GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.

Product Specifications

Product Name Alternative

GM-CSF Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-rat-cho.html

Purity

95.00

Smiles

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Formula

116630 (Gene_ID) P48750 (A18-K144) (Accession)

Molecular Weight

Approximately 16-26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]van Nieuwenhuijze A, et al. GM-CSF as a therapeutic target in inflammatory diseases. Mol Immunol. 2013 Dec;56 (4) :675-82.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]
TA504859AM 100 µL

PGM3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]

Sign In for Pricing
View Details
Human SAMD8 activation kit by CRISPRa
GA115445 1 Kit

Human SAMD8 activation kit by CRISPRa

Sign In for Pricing
View Details
SLK Human Gene Knockout Kit (CRISPR)
KN420128 1 Kit

SLK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Human Gene Knockout Kit (CRISPR)
KN216080 1 Kit

P Glycoprotein (ABCB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PIIINP Antibody Pair Set
E-KAB-0164 50 µL & 100 µg

Human PIIINP Antibody Pair Set

Sign In for Pricing
View Details
CMH1 (MYH7) Human Gene Knockout Kit (CRISPR)
KN424521 1 Kit

CMH1 (MYH7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details