Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Rat (CHO)

GM-CSF Protein, Rat (CHO) is a hematopoietic growth factor and immune modulator.

Product Specifications

Product Name Alternative

GM-CSF Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-rat-cho.html

Purity

95.00

Smiles

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Formula

116630 (Gene_ID) P48750 (A18-K144) (Accession)

Molecular Weight

Approximately 16-26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]van Nieuwenhuijze A, et al. GM-CSF as a therapeutic target in inflammatory diseases. Mol Immunol. 2013 Dec;56 (4) :675-82.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF594 conjugate, 0.1mg/mL
BNC941260-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), 1mg/mL
BNUM1464-50 1x 50 µL

CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), 1mg/mL

Sign In for Pricing
View Details
1700001P01Rik (NM_028156) Mouse Tagged ORF Clone
MG201441 10 µg

1700001P01Rik (NM_028156) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Ccnk activation kit by CRISPRa
GA200588 1 Kit

Mouse Ccnk activation kit by CRISPRa

Sign In for Pricing
View Details
CLDN24 Human Gene Knockout Kit (CRISPR)
KN431066 1 Kit

CLDN24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
D-Arabinose-13C5 Phenylhydrazone
TRC-A764202-5MG 5 mg

D-Arabinose-13C5 Phenylhydrazone

Sign In for Pricing
View Details