Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

Product Specifications

Product Name Alternative

Nucleocapsid protein; NC; Protein N

Abbreviation

Recombinant Avian infectious bronchitis virus N protein

Gene Name

N

UniProt

Q8JMI6

Expression Region

1-409aa

Organism

Avian infectious bronchitis virus (strain SAIB20) (IBV)

Target Sequence

MASGKATGKTDAPAPVIKLGGPRPPKVGSSGNASWFQAIKAKKLNSPQPKFEGSGVPDNENLKTSQQHGYWRRQARFKPGKGGRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADVKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRPPSREGSRGRRSGSEDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRTSSPAPRQQRLKKEKRPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Microbiology

Relevance

Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.3 kDa

References & Citations

"Sequence analysis of the N nucleocapsid protein gene of infectious bronchitis virus strains in Sichuan, China." Hongning W., Sheng Z., Chun L. Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MANF Antibody
NBP2-99775-100ul 100 µL

Rabbit Polyclonal MANF Antibody

Sign In for Pricing
View Details
RNF125 Polyclonal Antibody
MBS8569851-01 0.1 mL

RNF125 Polyclonal Antibody

Sign In for Pricing
View Details
RNF125 Polyclonal Antibody
MBS8569851-02 0.1 mL (AF405L)

RNF125 Polyclonal Antibody

Sign In for Pricing
View Details
RNF125 Polyclonal Antibody
MBS8569851-03 0.1 mL (AF405S)

RNF125 Polyclonal Antibody

Sign In for Pricing
View Details
RNF125 Polyclonal Antibody
MBS8569851-04 0.1 mL (AF610)

RNF125 Polyclonal Antibody

Sign In for Pricing
View Details
RNF125 Polyclonal Antibody
MBS8569851-05 0.1 mL (AF635)

RNF125 Polyclonal Antibody

Sign In for Pricing
View Details