Recombinant Enterobacteria phage M13 Attachment protein G3P (III)
Recombinant Enterobacteria phage M13 Attachment protein G3P (III)
Product Specifications
Product Name Alternative
Gene 3 protein (G3P), G3P Minor coat protein
UniProt
P69168
Expression Region
19-424aa
Tag
N-terminal 6xHis-tagged
Field of Research
Infectious Disease & Virology
Molecular Weight
44.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
AA Sequence
AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFSAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940050-100 1x 100 µL
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682345-500 1x 500 µL
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472391-500 1x 500 µL
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471867-100 1x 100 µL
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details