Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tityus serrulatus Alpha-mammal toxin Ts2

Product Specifications

Product Name Alternative

P-Mice-beta* NaTx5.1 (Tityustoxin II) (Toxin T1-IV) (TsTX III-8) (TsTX-III)

Abbreviation

Recombinant Tityus serrulatus Alpha-mammal toxin Ts2 protein

UniProt

P68410

Expression Region

1-62aa

Organism

Tityus serrulatus (Brazilian scorpion)

Target Sequence

KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin acts on Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.5/SCN5A, Nav1.6/SCN8A and Nav1.7/SCN9A voltage-gated sodium channels, with the highest affinity for Nav1.3/SCN3A, followed by Nav1.6/SCN8A and Nav1.7/SCN9A which are affected almost equally. Interestingly, shows a significant shift of the voltage dependence of activation for Nav1.3/SCN3A that is characteristic of beta-toxins . In addition, in presence of LPS, this toxin inhibits the release of NO, IL-6 and TNF-alpha in J774.1 cells . Further, in the absence of LPS, it stimulates the production of the anti-inflammatory cytokine IL-10 . This toxin is active on mammals.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.9 kDa

References & Citations

"The beta-type toxin Ts II from the scorpion Tityus serrulatus: amino acid sequence determination and assessment of biological and antigenic properties." Mansuelle P., Martin-Eauclaire M.-F., Chavez-Olortegui C., de Lima M.E., Rochat H., Granier C. Nat. Toxins 1:119-125 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Beta-Site App-Cleaving Enzyme 2 BACE 2 ELISA Kit
BG-RAT10369 1 Each

Rat Beta-Site App-Cleaving Enzyme 2 BACE 2 ELISA Kit

Ask
View Details
TACC3 Antibody
A72303-50UG 50 µg

TACC3 Antibody

Ask
View Details
Nanog, Phosphorylated (Ser71) (Homeobox Transcription Factor Nanog, Homeobox Protein NANOG, hNanog) (Biotin)
MBS6489358-01 0.2 mL

Nanog, Phosphorylated (Ser71) (Homeobox Transcription Factor Nanog, Homeobox Protein NANOG, hNanog) (Biotin)

Ask
View Details
Nanog, Phosphorylated (Ser71) (Homeobox Transcription Factor Nanog, Homeobox Protein NANOG, hNanog) (Biotin)
MBS6489358-02 5x 0.2 mL

Nanog, Phosphorylated (Ser71) (Homeobox Transcription Factor Nanog, Homeobox Protein NANOG, hNanog) (Biotin)

Ask
View Details
SOCS-2 discontinued
542441-01 30ul

SOCS-2 discontinued

Ask
View Details
SOCS-2 discontinued
542441-02 100 µL

SOCS-2 discontinued

Ask
View Details