Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

Product Specifications

Product Name Alternative

NAD-ME, Malic enzyme 2

UniProt

P23368

Tag

C-terminal 6xHis-tagged

Field of Research

Metabolism Research

Purity

>95% as determined by SDS-PAGE and HPLC.

Bioactivity

Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975) . The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 0.6 mM

Form

0.2μm filtered PBS, pH 7.4. , lyophilized

Molecular Weight

64.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 (CVID3/155), Biotin conjugate, 0.1mg/mL
BNCB0155-500 1x 500 µL

CD19 (CVID3/155), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rBP53-12), CF405S conjugate, 0.1mg/mL
BNC042094-500 1x 500 µL

P53 Tumor Suppressor Protein (rBP53-12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPART (NM_001142295) Human Over-expression Lysate
LC428018 20 µg

SPART (NM_001142295) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene A RAM
HA110023.100G 100 g

Polystyrene A RAM

Sign In for Pricing
View Details
Human FANCD2 activation kit by CRISPRa
GA101519 1 Kit

Human FANCD2 activation kit by CRISPRa

Sign In for Pricing
View Details
2310009B15Rik Mouse Gene Knockout Kit (CRISPR)
KN500231 1 Kit

2310009B15Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details