Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

Product Specifications

Product Name Alternative

NAD-ME, Malic enzyme 2

UniProt

P23368

Tag

C-terminal 6xHis-tagged

Field of Research

Metabolism Research

Purity

>95% as determined by SDS-PAGE and HPLC.

Bioactivity

Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975) . The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 0.6 mM

Form

0.2μm filtered PBS, pH 7.4. , lyophilized

Molecular Weight

64.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS520320 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
BCIP RED, 100 mg
#10004 1x 100 mg

BCIP RED, 100 mg

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI1E3]
CF814546 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Recombinant Human ADSL/Adenylosuccinate Lyase Protein (His Tag)
PKSH031168 100 µg

Recombinant Human ADSL/Adenylosuccinate Lyase Protein (His Tag)

Sign In for Pricing
View Details
Bromoperidol Decanoate
TRC-B686130-2.5MG 2.5 mg

Bromoperidol Decanoate

Sign In for Pricing
View Details
Nudt10 (NM_001031664) Mouse Tagged ORF Clone
MG201320 10 µg

Nudt10 (NM_001031664) Mouse Tagged ORF Clone

Sign In for Pricing
View Details