Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

Product Specifications

Product Name Alternative

NAD-ME, Malic enzyme 2

UniProt

P23368

Tag

C-terminal 6xHis-tagged

Field of Research

Metabolism Research

Purity

>95% as determined by SDS-PAGE and HPLC.

Bioactivity

Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975) . The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 0.6 mM

Form

0.2μm filtered PBS, pH 7.4. , lyophilized

Molecular Weight

64.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBNL1 (NM_207295) Human Over-expression Lysate
LC404078 20 µg

MBNL1 (NM_207295) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn2r63 Mouse Gene Knockout Kit (CRISPR)
KN519194 1 Kit

Vmn2r63 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-AKT1/2/3 Antibody [ST48-09]
ET1609-51TR 20 µL

Anti-AKT1/2/3 Antibody [ST48-09]

Sign In for Pricing
View Details
OR10H1 Human Gene Knockout Kit (CRISPR)
KN421850 1 Kit

OR10H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS508226 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Recombinant PGK1 Antibody
RC-5210-01 50 μL

Recombinant PGK1 Antibody

Sign In for Pricing
View Details