Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Der p 23, Dermatophagoides pteronyssinus (HEK293, His)

The Der p 23 protein was identified as a member of the allergic house dust mite proteins and does not exhibit chitin-binding ability in vitro. This unique feature distinguishes Der p 23 from other proteins known for their affinity to chitin, emphasizing its unique properties. Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His) is the recombinant Der p 23 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Der p 23 Protein, Dermatophagoides pteronyssinus (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/der-p-23-protein-dermatophagoides-pteronyssinus-hek293-his.html

Purity

95.00

Smiles

ANDNDDDPTTTVHPTTTEQPDDKFECPSRFGYFADPKDPHKFYICSNWEAVHKDCPGNTRWNEDEETCT

Molecular Formula

113788516 (Gene_ID) L7N6F8 (A22-T90) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP2 Mouse Monoclonal Antibody
orb783237-01 50 μL

USP2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
USP2 Mouse Monoclonal Antibody
orb783237-02 100 µL

USP2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant human FGF basic/FGF-2 protein
ATGP4117-250 250 µg

Recombinant human FGF basic/FGF-2 protein

Sign In for Pricing
View Details
OR2M2 Antibody
A23715-50UG 50 µg

OR2M2 Antibody

Sign In for Pricing
View Details
Sarcandrolide D
HYB18503-01 5 mg

Sarcandrolide D

Sign In for Pricing
View Details
Sarcandrolide D
HYB18503-02 10 mg

Sarcandrolide D

Sign In for Pricing
View Details