Recombinant Human Parathyroid Hormone/Parathormone/PTH (1-84)
Recombinant Human Parathyroid Hormone, Parathormone, PTH (1-84)
Product Specifications
Field of Research
Metabolism Research
Endotoxin
Ess than 0.1 ng, μg (1 IEU, μg) as determined by LAL test
Purity
Greater than 95% as determined by reducing SDS-PAGE
Storage Conditions
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Notes
For research use only.
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740012-500 1x 500 µL
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940414-100 1x 100 µL
Chromogranin A (CGA/414), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details