Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apolipoprotein A-I (Apoa1)

Product Specifications

Product Name Alternative

(Apo-AI) (ApoA-I) (Apolipoprotein A1) (ProapoA-I)

Abbreviation

Recombinant Mouse Apoa1 protein

Gene Name

Apoa1

UniProt

Q00623

Expression Region

19-264aa

Organism

Mus musculus (Mouse)

Target Sequence

WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT) . As part of the SPAP complex, activates spermatozoa motility.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.7 kDa

References & Citations

"Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications." Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P. Biochim. Biophys. Acta 1764:1363-1371 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse SAA (Serum Amyloid A) ELISA Kit
E-MSEL-M0091-01 24 Tests

Mini Sample Mouse SAA (Serum Amyloid A) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SAA (Serum Amyloid A) ELISA Kit
E-MSEL-M0091-02 48 Tests

Mini Sample Mouse SAA (Serum Amyloid A) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SAA (Serum Amyloid A) ELISA Kit
E-MSEL-M0091-03 96 Tests

Mini Sample Mouse SAA (Serum Amyloid A) ELISA Kit

Sign In for Pricing
View Details
IFluor® 594-streptavidin conjugate
16962-AAT 200 µg

IFluor® 594-streptavidin conjugate

Sign In for Pricing
View Details
Higenamine Hydrobromide Salt
TRC-H325800-25MG 25 mg

Higenamine Hydrobromide Salt

Sign In for Pricing
View Details
Cynomolgus CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Tag Free (MALS verified)
CDA-C52W3-1mg 1 mg

Cynomolgus CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Tag Free (MALS verified)

Sign In for Pricing
View Details