Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-3 protein (LGALS3) (Active)

Product Specifications

Product Name Alternative

Gal-3, Carbohydrate-binding protein 35, CBP 35, Galactose-specific lectin 3, Galactoside-binding protein

Abbreviation

Recombinant Human LGALS3 protein (Active)

Gene Name

LGALS3

UniProt

P17931

Expression Region

2-250aa

Organism

Homo sapiens (Human)

Target Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Neuroscience

Relevance

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity) . In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. {ECO:0000250, ECO:0000269|PubMed:15181153, ECO:0000269|PubMed:19594635, ECO:0000269|PubMed:19616076}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to agglutinate human red blood cells is less than 10 μg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1 x PBS, pH 7.4, 3mM DTT

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis (By similarity) . In the nucleus

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRG4 AAV siRNA Pooled Vector
32167161 1.0 µg

NRG4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Goat Tudor domain containing protein 6 ELISA Kit
MBS7271071-01 48 Well

Goat Tudor domain containing protein 6 ELISA Kit

Sign In for Pricing
View Details
Goat Tudor domain containing protein 6 ELISA Kit
MBS7271071-02 96 Well

Goat Tudor domain containing protein 6 ELISA Kit

Sign In for Pricing
View Details
Goat Tudor domain containing protein 6 ELISA Kit
MBS7271071-03 5x 96 Well

Goat Tudor domain containing protein 6 ELISA Kit

Sign In for Pricing
View Details
Goat Tudor domain containing protein 6 ELISA Kit
MBS7271071-04 10x 96 Well

Goat Tudor domain containing protein 6 ELISA Kit

Sign In for Pricing
View Details
ATX Inhibitor 17
MBS5814990 Inquire

ATX Inhibitor 17

Sign In for Pricing
View Details